Structure of PDB 7ohx Chain t

Receptor sequence
>7ohxt (length=202) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VRAESIVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKEKT
TYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETVKLTKNVYPLLK
VIAPYVVPSLSSIRSLIQKRGRIIYKAEPHEIVLNDNNIVEEQLGDHGII
CVEDIIHEIATMGESFSVCNFFLVSGFGSLNRLRKIKQREAESNAATAPV
IE
3D structure
PDB7ohx Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Chaint
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t A63 L66 R70 R77 Q91 H92 I93 A94 F99 K132 R146 R148 L151 V153 I155 F160 T171 S278 G279 F280 K288 R292 A304 A305 A8 L11 R15 R22 Q36 H37 I38 A39 F44 K49 R63 R65 L68 V70 I72 F77 T88 S175 G176 F177 K185 R189 A195 A196
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohx, PDBe:7ohx, PDBj:7ohx
PDBsum7ohx
PubMed34813592
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]