Structure of PDB 7m4y Chain t

Receptor sequence
>7m4yt (length=86) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
ANSAQAKKRARQNVKARKHNASLRSMVRTYIKRTLSAIAGGDYAVATEAY
KKAVPVIDRMADKGIIHKNKAARHKSRLNAQVKALA
3D structure
PDB7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
Chaint
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna t A2 N3 Q6 K9 R10 R12 Q13 N14 R18 H20 N21 S26 M27 T30 R34 D59 R60 D63 K64 H68 K71 A73 R74 K76 S77 R78 N80 K84 A1 N2 Q5 K8 R9 R11 Q12 N13 R17 H19 N20 S25 M26 T29 R33 D58 R59 D62 K63 H67 K70 A72 R73 K75 S76 R77 N79 K83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
PDBsum7m4y
PubMed34044590
UniProtB7I5N9|RS20_ACIB5 Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]