Structure of PDB 7d6z Chain t

Receptor sequence

>7d6zt (length=114) Species: 562 (Escherichia coli) [Search protein sequence]

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKP

3D structure

PDB

7d6z Structural insights into the interplay of protein biogenesis factors with the 70S ribosome.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	K78 M81 R92	K77 M80 R91
BS02	rna	t	H14 I17 Y23 G24 V25 G26 T28 R29 Y86 R87 R90 H91 V97 R98 G99 Q100 R101 T102 K103 N105 R107 T108 R109 K110 R113 P115	H13 I16 Y22 G23 V24 G25 T27 R28 Y85 R86 R89 H90 V96 R97 G98 Q99 R100 T101 K102 N104 R106 T107 R108 K109 R112 P114

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7d6z, PDBe:7d6z, PDBj:7d6z
PDBsum	7d6z
PubMed	33761323
UniProt	P0A7S9\|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)