Structure of PDB 6xir Chain t

Receptor sequence
>6xirt (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRA
TRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQA
ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKF
ADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKAL
PDAVTIIEPKEEEPILAPSVKDY
3D structure
PDB6xir Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
Chaint
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t A3 I5 S6 K7 R9 S139 K141 R146 A147 F156 I158 H159 S160 Q162 P163 Q179 G180 V181 K185 L202 P203 D204 A1 I3 S4 K5 R7 S137 K139 R144 A145 F154 I156 H157 S158 Q160 P161 Q177 G178 V179 K183 L200 P201 D202
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri May 9 20:09:30 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1472         else:
=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1474     
   1475     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xir', asym_id = 't', title = 'Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xir', asym_id='t', title='Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.')
    840 
    841     if go:
=>  842         display_go(go,uniprot,pdbid,asym_id)
    843     return pubmed,uniprot
    844 
global display_go = <function display_go>, go = '0003723,0003735,0006412,0015935', uniprot = '', pdbid = '6xir', asym_id = 't'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015935', uniprot='', pdbid='6xir', asym_id='t')
    481         '''.replace("$namespace_link",namespace_link
    482           ).replace("$namespace",namespace
=>  483           ).replace("$uniprot",u
    484         ))
    485         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>