Structure of PDB 6tnn Chain t

Receptor sequence
>6tnnt (length=36) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
KVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chaint
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t K2 R4 P5 S6 V7 K8 I10 K15 R19 K20 P30 K31 Q36 K1 R3 P4 S5 V6 K7 I9 K14 R18 K19 P29 K30 Q35
BS02 ZN t C27 H32 C26 H31
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP20278|RL36_BACSU Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]