Structure of PDB 6spf Chain t

Receptor sequence
>6spft (length=86) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
ANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDLEKAQAAF
TAAVPVIDRMADKGIIHKNKAARHKSRLSGHIKALS
3D structure
PDB6spf Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.
Chaint
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna t A2 N3 T4 S6 K9 R10 R17 R18 N21 S23 R25 S26 M27 R29 T30 Y31 P56 R60 D63 K64 K69 N70 A73 R74 H75 K76 S77 R78 H82 K84 A1 N2 T3 S5 K8 R9 R16 R17 N20 S22 R24 S25 M26 R28 T29 Y30 P55 R59 D62 K63 K68 N69 A72 R73 H74 K75 S76 R77 H81 K83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6spf, PDBe:6spf, PDBj:6spf
PDBsum6spf
PubMed31611393
UniProtA0A072ZDZ9

[Back to BioLiP]