Structure of PDB 5tbw Chain t

Receptor sequence

>5tbwt (length=193) Species: 559292 (Saccharomyces cerevisiae S288C)

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

3D structure

• PDB: 5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.
• Chain: t
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	I3 K5 L7 P8 L10 K11 N12 H13 F14 R15 K16 H17 W18 Q19 K23 Q28 A29 K31 K32 R35 R36 R39 R42 R55 V58 R59 A60 P61 T62 Y65 N66 K68 R70 R73 L77 D98 H99 R100 R101 R104 G130 K131 A132 R168 R171 R174 S175 K177 K178 F179 K185 R186	I2 K4 L6 P7 L9 K10 N11 H12 F13 R14 K15 H16 W17 Q18 K22 Q27 A28 K30 K31 R34 R35 R38 R41 R54 V57 R58 A59 P60 T61 Y64 N65 K67 R69 R72 L76 D97 H98 R99 R100 R103 G129 K130 A131 R167 R170 R173 S174 K176 K177 F178 K184 R185
BS02	rna	t	F26 G30 S34	F25 G29 S33
BS03	MG	t	N129 G130	N128 G129

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
• PDBsum: 5tbw
• PubMed: 29064494
• UniProt: Q12690|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)