Structure of PDB 5t6r Chain t

Receptor sequence

>5t6rt (length=112) Species: 559292 (Saccharomyces cerevisiae S288C)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 5t6r Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.
• Chain: t
• Resolution: 4.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	A2 R4 V5 F7 R8 R9 R10 P12 Y13 N14 T15 R16 S17 K19 K24 T25 P26 G27 R31 K36 K37 L38 T40 R41 K43 G45 Q52 I54 T56 R58 P59 R60 T64 S66 K67 T68 K70 T71 S73 R74 Y76 G78 R80 N83 R91 A92 I95	A1 R3 V4 F6 R7 R8 R9 P11 Y12 N13 T14 R15 S16 K18 K23 T24 P25 G26 R30 K35 K36 L37 T39 R40 K42 G44 Q51 I53 T55 R57 P58 R59 T63 S65 K66 T67 K69 T70 S72 R73 Y75 G77 R79 N82 R90 A91 I94

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5t6r, PDBe:5t6r, PDBj:5t6r
• PDBsum: 5t6r
• PubMed: 28179369
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)