Structure of PDB 5t5h Chain t

Receptor sequence

>5t5ht (length=93) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]

VNYPKKKTMYCPDARCKAHKSFKVVQYKAGKARLYARGKRRYDRKQSGYG
GQTKPIFHKKAKTTKKIVLKLQCSNCKSIIQNVLKRTKHFELN

3D structure

PDB

5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.

Chain

Resolution

2.54 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	t	R38 R41 R42 R45 K46 G49 Y50 T54 K55	R37 R40 R41 R44 K45 G48 Y49 T53 K54
BS02	rna	t	V2 N3 Y4 P5 K8 T9 M10 Y11 K18 A19 H20 Y28 A30 G31 K32 R34 Y36 A37 R38 G39 R41 G52 Q53 P56 I57 F58 K60 K61 A62 K63 T65 K66 K67 V69 I80 Q82 V84 K86 R87 T88 K89 H90	V1 N2 Y3 P4 K7 T8 M9 Y10 K17 A18 H19 Y27 A29 G30 K31 R33 Y35 A36 R37 G38 R40 G51 Q52 P55 I56 F57 K59 K60 A61 K62 T64 K65 K66 V68 I79 Q81 V83 K85 R86 T87 K88 H89
BS03	ZN	t	C12 C17 C74	C11 C16 C73

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links