Structure of PDB 3jct Chain t

Receptor sequence

>3jctt (length=287) Species: 559292 (Saccharomyces cerevisiae S288C)

NPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAESIVAK
TLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEGLIREKTTY
DGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYP
LLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIV
EEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNR
LRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN

3D structure

• PDB: 3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
• Chain: t
• Resolution: 3.08 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	t	R30 R33 S278 G279 F280 G281 N284	R16 R19 S243 G244 F245 G246 N249
BS02	rna	t	F55 R57 L151	F41 R43 L116
BS03	rna	t	R49 E59 L66 R70 R77 H92 I93 K97 F99 K132 R146 R148 G149 L151 V153 I155 E170 T171 R275 F280 K288 N303	R35 E45 L52 R56 R63 H78 I79 K83 F85 K97 R111 R113 G114 L116 V118 I120 E135 T136 R240 F245 K253 N268

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0042134 rRNA primary transcript binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:3jct, PDBe:3jct, PDBj:3jct
• PDBsum: 3jct
• PubMed: 27251291
• UniProt: P40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)