Structure of PDB 6h58 Chain ss

Receptor sequence
>6h58ss (length=79) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB6h58 Structure of a hibernating 100S ribosome reveals an inactive conformation of the ribosomal protein S1.
Chainss
Resolution7.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ss R2 S3 L4 K5 F9 H13 W33 R35 R36 H51 G53 R54 K69 G71 E72 T76 R77 T78 Y79 R1 S2 L3 K4 F8 H12 W32 R34 R35 H50 G52 R53 K68 G70 E71 T75 R76 T77 Y78
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h58, PDBe:6h58, PDBj:6h58
PDBsum6h58
PubMed30177741
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]