Structure of PDB 6y57 Chain sh

Receptor sequence

>6y57sh (length=41) Species: 9606 (Homo sapiens) [Search protein sequence]

HKRKKVKLAVLKYLRRECPSFMASHFDRHYCGKCCLTYCFN

3D structure

PDB

6y57 Dynamics of uS19 C-Terminal Tail during the Translation Elongation Cycle in Human Ribosomes.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	sh	H88 K89 R90 K94 V97 R113 A128 Y135 G137	H1 K2 R3 K7 V10 R15 A23 Y30 G32

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0031386	protein tag activity
GO:0031625	ubiquitin protein ligase binding
GO:0046872	metal ion binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0016567	protein ubiquitination
GO:0019941	modification-dependent protein catabolic process

	Cellular Component
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005741	mitochondrial outer membrane
GO:0005789	endoplasmic reticulum membrane
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030666	endocytic vesicle membrane
GO:0031982	vesicle
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6y57, PDBe:6y57, PDBj:6y57
PDBsum	6y57
PubMed	32268098
UniProt	P62979\|RS27A_HUMAN Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS27A)