Structure of PDB 8gzu Chain sb

Receptor sequence

>8gzusb (length=279) Species: 312017 (Tetrahymena thermophila SB210)

SICLESISGTIKGLQKANYVVEHNPNLTSEEKKHLKQFLVYRYNPADPHD
QPKYVSYWCDIKKFPPMFLDAILYIKNELDPTLSIRRSCREGICGSCAVN
CDGLHTLACISGFNRDLSKPTIITPLGHMFILKDLVVDMTNFYAQYKMIE
PYLKRKTPKPDANKEYPQSPEQRALLDGLYECVLCAACSTSCPSYWWHPD
RYLGPAILQQAYRWIVDSRDEYTQERIERIAEDVRLDDCQQIGMCSFTCP
KGLNPQLSLKNLMDMVKDFRQKRIEQEVL

3D structure

• PDB: 8gzu Structures of Tetrahymena thermophila respiratory megacomplexes on the tubular mitochondrial cristae.
• Chain: sb
• Resolution: 4.18 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	sb	R120 C122 R123 G125 C127 G128 S129 C130 L140 C142	R87 C89 R90 G92 C94 G95 S96 C97 L107 C109
BS02	SF4	sb	C215 V216 L217 C218 A219 C221 A239 C282	C182 V183 L184 C185 A186 C188 A206 C249
BS03	F3S	sb	C225 C272 Q273 Q274 I275 M277 C278 Q289	C192 C239 Q240 Q241 I242 M244 C245 Q256

Gene Ontology

Molecular Function

• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005743 mitochondrial inner membrane

External links

• PDB: RCSB:8gzu, PDBe:8gzu, PDBj:8gzu
• PDBsum: 8gzu
• PubMed: 37248254
• UniProt: I7M403