Structure of PDB 8ip9 Chain sa

Receptor sequence
>8ip9sa (length=100) Species: 4565 (Triticum aestivum) [Search protein sequence]
STDDLVQMFPARARRRFKRGLKRKPMALVKKLRKAKKDAPAGEKPEPVRT
HLRNMIIVPEMIGSLIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKH
3D structure
PDB8ip9 Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
Chainsa
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna sa P47 A48 R49 R51 R52 R53 R56 R60 K61 K68 R86 H88 R90 N91 Y106 G108 F111 Y124 A126 S131 Y132 V135 H137 P10 A11 R12 R14 R15 R16 R19 R23 K24 K31 R49 H51 R53 N54 Y69 G71 F74 Y87 A89 S94 Y95 V98 H100
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ip9, PDBe:8ip9, PDBj:8ip9
PDBsum8ip9
PubMed38267667
UniProtW5ASA4

[Back to BioLiP]