Structure of PDB 7zw0 Chain sS

Receptor sequence

>7zw0sS (length=258) Species: 580240 (Saccharomyces cerevisiae W303)

ARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRL
VYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PNIKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERH
DGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEE
RDRRRAQQ

3D structure

• PDB: 7zw0 Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
• Chain: sS
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	sS	A2 R3 G4 K7 H8 K10 L12 H16 L19 D21 K22 C26 Y27 A28 P29 R30 A33 G34 K37 L38 R49 M66 R77 K106 R108 L131 G132 K133 K134 G135 V140 T146 R148 K155 R187 R200 H201 D202 I248 R255	A1 R2 G3 K6 H7 K9 L11 H15 L18 D20 K21 C25 Y26 A27 P28 R29 A32 G33 K36 L37 R48 M65 R76 K105 R107 L130 G131 K132 K133 G134 V139 T145 R147 K154 R186 R199 H200 D201 I247 R254
BS02	MG	sS	R30 T81	R29 T80

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7zw0, PDBe:7zw0, PDBj:7zw0
• PDBsum: 7zw0
• PubMed: 36113412
• UniProt: P0CX36|RS4B_YEAST Small ribosomal subunit protein eS4B (Gene Name=RPS4B)