Structure of PDB 4u3n Chain sM

Receptor sequence
>4u3nsM (length=104) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KEIVKSNTSSKKADVPPPSADPSKARKNRPRPSGNEGAIRDKTAGRRNNR
SKDVTDSATTKKSAEKEAQADAAAEIAEDAAEAELNQQANNQFNKVPEAK
KVEL
3D structure
PDB4u3n ?
ChainsM
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna sM R68 N71 R72 V76 S79 A80 T81 K83 R46 N49 R50 V54 S57 A58 T59 K61
BS02 rna sM S28 T30 S31 S32 K33 A42 D43 P44 K46 A47 R48 R51 S6 T8 S9 S10 K11 A20 D21 P22 K24 A25 R26 R29
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030371 translation repressor activity
GO:0042162 telomeric DNA binding
GO:0043022 ribosome binding
GO:0045142 triplex DNA binding
GO:0061770 translation elongation factor binding
Biological Process
GO:0000723 telomere maintenance
GO:0006414 translational elongation
GO:0006417 regulation of translation
GO:0031929 TOR signaling
GO:0043066 negative regulation of apoptotic process
GO:0043558 regulation of translational initiation in response to stress
GO:0141014 ribosome hibernation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u3n, PDBe:4u3n, PDBj:4u3n
PDBsum4u3n
PubMed25209664
UniProtP39015|STM1_YEAST Suppressor protein STM1 (Gene Name=STM1)

[Back to BioLiP]