Structure of PDB 4u4y Chain s8

Receptor sequence

>4u4ys8 (length=188) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

PDB

4u4y ?

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s8	G2 R5 S7 H9 K10 R11 A13 G15 K17 R18 F21 K23 K24 R25 K26 F27 L29 G30 R31 Q32 P33 A34 K41 R42 I43 H44 R47 T48 R49 G50 G51 K54 R56 N64 S66 G71 I72 K75 S86 N87 T97 K98 K137 N138 K142 R146 S170 R172 S176 R178 D180	G1 R4 S6 H8 K9 R10 A12 G14 K16 R17 F20 K22 K23 R24 K25 F26 L28 G29 R30 Q31 P32 A33 K40 R41 I42 H43 R46 T47 R48 G49 G50 K53 R55 N63 S65 G70 I71 K74 S85 N86 T96 K97 K125 N126 K130 R134 S158 R160 S164 R166 D168
BS02	rna	s8	R92 T107 R110 S161 A162 K199	R91 T106 R109 S149 A150 K187

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u4y, PDBe:4u4y, PDBj:4u4y
PDBsum	4u4y
PubMed	25209664
UniProt	P0CX39\|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)

[Back to BioLiP]