Structure of PDB 4u4r Chain s8

Receptor sequence

>4u4rs8 (length=188) Species: 559292 (Saccharomyces cerevisiae S288C)

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

• PDB: 4u4r ?
• Chain: s8
• Resolution: 2.801 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s8	G2 R5 D6 S7 H9 K10 R11 A13 T14 A16 K17 R18 F21 R22 K23 K24 R25 K26 F27 L29 G30 R31 Q32 P33 A34 K41 R42 I43 H44 R47 T48 R49 G50 G51 N52 K54 R56 L58 R59 N64 S66 I72 K75 S86 N87 T97 K98 K137 N138 R141 K142 R146 S170 S171 R172 G174 Q175 S176 R178 D180	G1 R4 D5 S6 H8 K9 R10 A12 T13 A15 K16 R17 F20 R21 K22 K23 R24 K25 F26 L28 G29 R30 Q31 P32 A33 K40 R41 I42 H43 R46 T47 R48 G49 G50 N51 K53 R55 L57 R58 N63 S65 I71 K74 S85 N86 T96 K97 K125 N126 R129 K130 R134 S158 S159 R160 G162 Q163 S164 R166 D168
BS02	rna	s8	R92 R110 S161 A162 K199	R91 R109 S149 A150 K187

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u4r, PDBe:4u4r, PDBj:4u4r
• PDBsum: 4u4r
• PubMed: 25209664
• UniProt: P0CX39|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)