Structure of PDB 5on6 Chain s7

Receptor sequence
>5on6s7 (length=186) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SAPQAKILSQAPTELELQVAQAFVELENSSPELKAELRPLQFKSIREIDV
AGGKKALAIFVPVPSLAGFHKVQTKLTRELEKKFQDRHVIFLAERRILPK
PSRTSRQVQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQK
VLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPS
3D structure
PDB5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.
Chains7
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s7 V64 R96 R97 I98 P100 K101 R104 T105 R107 Q110 K111 R112 P113 R114 S115 R116 T117 L118 T119 K148 T177 G178 V63 R95 R96 I97 P99 K100 R103 T104 R106 Q109 K110 R111 P112 R113 S114 R115 T116 L117 T118 K147 T176 G177
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5on6, PDBe:5on6, PDBj:5on6
PDBsum5on6
PubMed29429877
UniProtP26786|RS7A_YEAST Small ribosomal subunit protein eS7A (Gene Name=RPS7A)

[Back to BioLiP]