Structure of PDB 5ndg Chain s7

Receptor sequence
>5ndgs7 (length=185) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
APQAKILSQAPTELELQVAQAFVELENSSPELKAELRPLQFKSIREIDVA
GGKKALAIFVPVPSLAGFHKVQTKLTRELEKKFQDRHVIFLAERRILPKP
SRTSRQVQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKV
LLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPS
3D structure
PDB5ndg Aminoglycoside interactions and impacts on the eukaryotic ribosome.
Chains7
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s7 R96 R97 P100 K101 R104 T105 S106 R107 Q110 K111 R112 P113 R114 S115 R116 T117 L118 T119 K148 G178 K179 R94 R95 P98 K99 R102 T103 S104 R105 Q108 K109 R110 P111 R112 S113 R114 T115 L116 T117 K146 G176 K177
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ndg, PDBe:5ndg, PDBj:5ndg
PDBsum5ndg
PubMed29208708
UniProtP26786|RS7A_YEAST Small ribosomal subunit protein eS7A (Gene Name=RPS7A)

[Back to BioLiP]