Structure of PDB 5obm Chain s6

Receptor sequence

>5obms6 (length=218) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVF
KISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGA
IVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKE
DDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQA
QREAAAEYAQLLAKRLSE

3D structure

PDB

5obm Aminoglycoside interactions and impacts on the eukaryotic ribosome.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s6	N4 S6 Q13 T15 S53 N56 K58 Q59 G60 F61 P62 G66 V67 R72 K74 L75 S82 C83 Y84 R85 R87 R88 D89 G90 R92 K93 R94 K95 S96 A107 V108 R132 L133 G134 K136 R137 N139 R154 R159 R160 V162 K164 Y169 K171 A172 P173 K174 I175 Q176 R177 L178 R183 Q185 R186 K187 R188 Q190 R191 K194 N197 A198 Q201 R202	N4 S6 Q13 T15 S53 N56 K58 Q59 G60 F61 P62 G66 V67 R72 K74 L75 S82 C83 Y84 R85 R87 R88 D89 G90 R92 K93 R94 K95 S96 A107 V108 R132 L133 G134 K136 R137 N139 R154 R159 R160 V162 K164 Y169 K171 A172 P173 K174 I175 Q176 R177 L178 R183 Q185 R186 K187 R188 Q190 R191 K194 N197 A198 Q201 R202
BS02	MG	s6	K74 R94	K74 R94

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5obm, PDBe:5obm, PDBj:5obm
PDBsum	5obm
PubMed	29208708
UniProt	P0CX37\|RS6A_YEAST Small ribosomal subunit protein eS6A (Gene Name=RPS6A)

[Back to BioLiP]