Structure of PDB 4u4z Chain s4

Receptor sequence

>4u4zs4 (length=260) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRL
VYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PNIKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERH
DGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEE
RDRRRAQQGL

3D structure

PDB

4u4z ?

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s4	A2 R3 G4 P5 K6 K7 H8 K10 R11 L12 H16 L19 D21 K22 L23 S24 C26 Y27 A28 P29 R30 A33 G34 K37 R49 N57 G58 R59 M66 K75 K106 R108 Q130 L131 G132 K133 K134 G135 T146 R148 K155 G186 R187 E199 H201 D202 V219 T220 R221 I248	A1 R2 G3 P4 K5 K6 H7 K9 R10 L11 H15 L18 D20 K21 L22 S23 C25 Y26 A27 P28 R29 A32 G33 K36 R48 N56 G57 R58 M65 K74 K105 R107 Q129 L130 G131 K132 K133 G134 T145 R147 K154 G185 R186 E198 H200 D201 V218 T219 R220 I247
BS02	MG	s4	R30 T81	R29 T80

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:0032991	protein-containing complex
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u4z, PDBe:4u4z, PDBj:4u4z
PDBsum	4u4z
PubMed	25209664
UniProt	P0CX35\|RS4A_YEAST Small ribosomal subunit protein eS4A (Gene Name=RPS4A)

[Back to BioLiP]