Structure of PDB 5ndg Chain s2

Receptor sequence

>5ndgs2 (length=217) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNI
KPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAK
LSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPA
VKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQ
PLPVSPLDIYSDEASAQ

3D structure

PDB

5ndg Aminoglycoside interactions and impacts on the eukaryotic ribosome.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s2	Q87 K88 Q89 T90 R91 A92 G93 R97 K99 K116 K119 T159 K161 C162 G163 S164 R168 A180 S181 Y197 T198 Q199 S200 N201 K203 T204 R205 T206 E208 N209 K212	Q54 K55 Q56 T57 R58 A59 G60 R64 K66 K83 K86 T126 K128 C129 G130 S131 R135 A147 S148 Y164 T165 Q166 S167 N168 K170 T171 R172 T173 E175 N176 K179

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ndg, PDBe:5ndg, PDBj:5ndg
PDBsum	5ndg
PubMed	29208708
UniProt	P25443\|RS2_YEAST Small ribosomal subunit protein uS5 (Gene Name=RPS2)

[Back to BioLiP]