Structure of PDB 4u3n Chain s1

Receptor sequence

>4u3ns1 (length=216) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

VVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGRVVEVC
LADLQGSEDHSFRKIKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQT
LIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVIS
EILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFPLQNIHVRKVKLLK
QPKFDVGALMALHGEG

3D structure

PDB

4u3n ?

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	s1	K27 V65 H101 K116 W117 L120 R136 F138 Q146 N148 Q149 V150 K151 R152 H153 Y155 Q157 S158 S159 H160 R165 D203 I204 F205 P206 K214 K216	K8 V46 H82 K97 W98 L101 R117 F119 Q127 N129 Q130 V131 K132 R133 H134 Y136 Q138 S139 S140 H141 R146 D184 I185 F186 P187 K195 K197
BS02	rna	s1	G226 M229	G207 M210
BS03	OHX	s1	Q157 H160	Q138 H141
BS04	OHX	s1	D59 G63	D40 G44

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u3n, PDBe:4u3n, PDBj:4u3n
PDBsum	4u3n
PubMed	25209664
UniProt	P33442\|RS3A1_YEAST Small ribosomal subunit protein eS1A (Gene Name=RPS1A)

[Back to BioLiP]