Structure of PDB 4u4y Chain s0

Receptor sequence

>4u4ys0 (length=206) Species: 559292 (Saccharomyces cerevisiae S288C)

SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVG
KTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGR
FTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDS
PSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDL
YFYRDP

3D structure

• PDB: 4u4y ?
• Chain: s0
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s0	V31 R101 P104 G105 T108 N109 Y110 R113 E135 Y138	V30 R100 P103 G104 T107 N108 Y109 R112 E134 Y137

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0010494 cytoplasmic stress granule
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u4y, PDBe:4u4y, PDBj:4u4y
• PDBsum: 4u4y
• PubMed: 25209664
• UniProt: P32905|RSSA1_YEAST Small ribosomal subunit protein uS2A (Gene Name=RPS0A)