Structure of PDB 9c4g Chain s

Receptor sequence
>9c4gs (length=95) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
ELKIRDPRDIILAPVVSEKSYGLLDQNTYTFVVKPTANKTEIKIAIEQIF
GVKVTSVNTMNRKGKVRRTRTGVGKRPDTKRAIVTVAEGDRIDIF
3D structure
PDB9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.
Chains
Resolution2.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s E3 K5 R7 S19 E20 K21 N40 K41 T42 E43 K45 I46 N60 T61 M62 N63 R64 K65 K67 R69 T73 G74 G76 K77 R78 P79 K82 R83 I85 E1 K3 R5 S17 E18 K19 N38 K39 T40 E41 K43 I44 N58 T59 M60 N61 R62 K63 K65 R67 T71 G72 G74 K75 R76 P77 K80 R81 I83
External links