Structure of PDB 8y39 Chain s

Receptor sequence
>8y39s (length=82) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
ARSIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAV
YDGRKHVPVYVTEDMVGHKLGEFAPTRTFKGH
3D structure
PDB8y39 Synthetic macrolides overcoming MLS B K-resistant pathogens.
Chains
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s A2 R3 S4 I5 K6 K7 F10 H14 K18 K32 W34 R36 R37 Y52 D53 G54 R55 K70 G72 E73 T77 R78 T79 F80 H83 A1 R2 S3 I4 K5 K6 F9 H13 K17 K31 W33 R35 R36 Y51 D52 G53 R54 K69 G71 E72 T76 R77 T78 F79 H82
External links