Structure of PDB 8wi7 Chain s

Receptor sequence
>8wi7s (length=65) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
TRKCVFCSKKGQTIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIAV
AVKNAREVALLPFGS
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chains
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s K19 S24 K25 K47 I48 V58 Q59 Q61 R62 K69 N70 R72 E73 K3 S8 K9 K31 I32 V42 Q43 Q45 R46 K53 N54 R56 E57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0R7F7|RS182_MYCS2 Small ribosomal subunit protein bS18B (Gene Name=rpsR2)

[Back to BioLiP]