Structure of PDB 8qpp Chain s

Receptor sequence
>8qpps (length=90) Species: 1423 (Bacillus subtilis) [Search protein sequence]
KDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKV
DKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIE
3D structure
PDB8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1
Chains
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s K2 E15 R16 K25 N35 K36 T37 K53 N55 I56 M57 N58 Y59 K62 S63 V66 Y69 G71 S74 R75 R77 K82 K1 E14 R15 K24 N34 K35 T36 K52 N54 I55 M56 N57 Y58 K61 S62 V65 Y68 G70 S73 R74 R76 K81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
PDBsum8qpp
PubMed38177497
UniProtA0A063XB36

[Back to BioLiP]