Structure of PDB 8pw5 Chain s |
>8pw5s (length=94) Species: 10090 (Mus musculus) [Search protein sequence] |
GGGVPTDEEQATGLEREIMIAAQKGLDPYNMLPPKAASGTKEDPNLVPSI SNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTHYKLVPHQM |
|
PDB | 8pw5 SCAF1 drives the compositional diversity of mammalian respirasomes. |
Chain | s |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
s |
C61 C63 C83 C86 |
C58 C60 C80 C83 |
|
|
|
|