Structure of PDB 8gxq Chain s

Receptor sequence
>8gxqs (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
GPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDL
PGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLH
3D structure
PDB8gxq Structures of +1 nucleosome-bound PIC-Mediator complex.
Chains
Resolution5.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna s K104 N107 K42 N45
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0005515 protein binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gxq, PDBe:8gxq, PDBj:8gxq
PDBsum8gxq
PubMed36201575
UniProtA0JLT2|MED19_HUMAN Mediator of RNA polymerase II transcription subunit 19 (Gene Name=MED19)

[Back to BioLiP]