Structure of PDB 8cmj Chain s

Receptor sequence

>8cmjs (length=136) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

VQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVG
LDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELK
KAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSY

3D structure

PDB

8cmj Cryo-EM analysis of eukaryotic ribosome translocation intermediates

Chain

Resolution

3.79 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s	Q8 T9 F10 K12 H21 K30 P41 E42 G71 G72 G73 H74 V75 Q77 S121 R122 P124 E125 K128 F129 G133 A134 R135 S136 F138 Q139 K140 S141 Y142	Q2 T3 F4 K6 H15 K24 P35 E36 G65 G66 G67 H68 V69 Q71 S115 R116 P118 E119 K122 F123 G127 A128 R129 S130 F132 Q133 K134 S135 Y136

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cmj, PDBe:8cmj, PDBj:8cmj
PDBsum	8cmj
PubMed	38030725
UniProt	P0CX51\|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)