Structure of PDB 8c3a Chain s

Receptor sequence

>8c3as (length=171) Species: 5476 (Candida albicans) [Search protein sequence]

KSQNVMRELRIEKLVLNICVGESGDRLTRAAKVLEQLSGQTPVQSKARYT
VRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRSKNFSATGNFG
FGIDEHIDLGIKYDPSIGIYGMDFYVVMGRAGARVTRRKRARSTIGNSHK
TNKEDTIQWFKTRYDAEVLDK

3D structure

PDB

8c3a New crystal system to promote screening for new eukaryotic inhibitors

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s	K16 V18 N20 C22 S48 A50 R51 Y52 F57 I59 A66 H68 K94 N95 S97 A98 G103 F104 G105 G124 M125 D126 Y128 R140 K142	K13 V15 N17 C19 S45 A47 R48 Y49 F54 I56 A63 H65 K91 N92 S94 A95 G100 F101 G102 G121 M122 D123 Y125 R137 K139
BS02	rna	s	N7 M9 T44 V46 T70 R72 G135 R137 R141 R143 S146 G149 N150 H152	N4 M6 T41 V43 T67 R69 G132 R134 R138 R140 S143 G146 N147 H149

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum	8c3a
PubMed
UniProt	A0A8H6F1S5

[Back to BioLiP]