Structure of PDB 8bh6 Chain s

Receptor sequence
>8bh6s (length=84) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
SIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAVYD
GRKHVPVYVTEDMVGHKLGEFAPTRTFKGHVADD
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chains
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s S4 I5 K6 F10 H14 W34 R36 R37 Y52 G54 R55 G72 T77 R78 K81 G82 H83 V84 A85 D86 S1 I2 K3 F7 H11 W31 R33 R34 Y49 G51 R52 G69 T74 R75 K78 G79 H80 V81 A82 D83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ2FW10|RS19_STAA8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]