Structure of PDB 8bge Chain s

Receptor sequence
>8bges (length=88) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB8bge Modulation of translational decoding by m 6 A modification of mRNA.
Chains
Resolution2.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s Q40 R89 Q39 R88
BS02 rna s T22 G23 Q28 H42 H46 K48 D49 H51 S52 R54 K65 Y69 K73 T21 G22 Q27 H41 H45 K47 D48 H50 S51 R53 K64 Y68 K72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bge, PDBe:8bge, PDBj:8bge
PDBsum8bge
PubMed37553384
UniProtP0ADZ4|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]