Structure of PDB 7qg8 Chain s

Receptor sequence
>7qg8s (length=37) Species: 663 (Vibrio alginolyticus) [Search protein sequence]
MDINWRHNQSTFYHFTSDHRISGWKETNAMYVALNSQ
3D structure
PDB7qg8 Ribosome collisions induce mRNA cleavage and ribosome rescue in bacteria.
Chains
Resolution3.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s I122 R125 H126 N127 F131 T135 H138 R139 I140 K144 E145 T146 N147 M149 Y150 V151 A152 L153 N154 S155 Q156 I3 R6 H7 N8 F12 T16 H19 R20 I21 K25 E26 T27 N28 M30 Y31 V32 A33 L34 N35 S36 Q37
External links