Structure of PDB 7q0r Chain s

Receptor sequence

>7q0rs (length=172) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

SDKSQNVMRELRIEKLVLNICVGESGDRLTRAAKVLEQLSGQTPVQSKAR
YTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRSKNFSATGN
FGFGIDEHIDLGIKYDPSIGIYGMDFYVVMGRAGARVTRRKRARSTIGNS
HKTNKEDTIQWFKTRYDAEVLD

3D structure

PDB

7q0r E-site drug specificity of the human pathogen Candida albicans ribosome.

Chain

Resolution

2.67 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s	K16 V18 N20 C22 S48 A50 R51 Y52 F57 I59 A66 K94 N95 S97 A98 T99 N101 G103 F104 G105 G124 M125 D126 Y128 K142	K15 V17 N19 C21 S47 A49 R50 Y51 F56 I58 A65 K93 N94 S96 A97 T98 N100 G102 F103 G104 G123 M124 D125 Y127 K141
BS02	rna	s	S2 D3 K4 N7 M9 R10 Q43 T44 V46 V69 T70 R72 G135 R137 R141 R143 S146 T147 G149 N150 H152	S1 D2 K3 N6 M8 R9 Q42 T43 V45 V68 T69 R71 G134 R136 R140 R142 S145 T146 G148 N149 H151

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q0r, PDBe:7q0r, PDBj:7q0r
PDBsum	7q0r
PubMed	35613268
UniProt	A0A1D8PHW1\|RL11_CANAL Large ribosomal subunit protein uL5 (Gene Name=RPL11)

[Back to BioLiP]