Structure of PDB 7pit Chain s

Receptor sequence
>7pits (length=92) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
DVTNVLLKPVLTEKVYFNQMGETKKYVFVVNPKASKTRVKLAFELVYGIK
PLKVNTLIRKPTTIRGGSRFPGLSKLEKLAVITLPKGIAISV
3D structure
PDB7pit Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chains
Resolution5.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s E14 K15 K34 S36 K37 R39 K41 L42 K54 N56 T57 L58 I59 K61 T63 T64 R66 F71 L77 E13 K14 K33 S35 K36 R38 K40 L41 K53 N55 T56 L57 I58 K60 T62 T63 R65 F70 L76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pit, PDBe:7pit, PDBj:7pit
PDBsum7pit
PubMed36171285
UniProtP75578|RL23_MYCPN Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]