Structure of PDB 7pir Chain s

Receptor sequence
>7pirs (length=92) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
DVTNVLLKPVLTEKVYFNQMGETKKYVFVVNPKASKTRVKLAFELVYGIK
PLKVNTLIRKPTTIRGGSRFPGLSKLEKLAVITLPKGIAISV
3D structure
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chains
Resolution12.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s D2 T13 E14 K15 F18 N19 E23 T24 K26 K34 S36 K37 L42 K51 L53 K54 N56 T57 L58 I59 R60 K61 R66 R70 F71 K76 K79 V82 D1 T12 E13 K14 F17 N18 E22 T23 K25 K33 S35 K36 L41 K50 L52 K53 N55 T56 L57 I58 R59 K60 R65 R69 F70 K75 K78 V81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtP75578|RL23_MYCPN Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]