Structure of PDB 7f9o Chain s

Receptor sequence

>7f9os (length=211) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]

TVCEPLGPDRPVWFPGTAPPPWLDGSLPGDFGFDPLGFGSEPESLRWFAQ
AELMHGRWAMLAVAGILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFV
TQMALMGWVEGRRWMDYLNPGSVDIEPRFPNRKNPTPDVGYPGGLWFDWG
NWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQVVYTGQGPLDNLFAHL
ADPGHCNIFSA

3D structure

PDB

7f9o Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.

Chain

Resolution

4.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	s	W163 R167	W108 R112
BS02	CLA	s	R112 Y196 P197 G198 F202 D203 G208 R219 E222	R57 Y141 P142 G143 F147 D148 G153 R164 E167
BS03	CLA	s	K221 N225 L228	K166 N170 L173
BS04	CLA	s	G235 F238 Q239 N250 H254 N262 I263	G180 F183 Q184 N195 H199 N207 I208
BS05	CLA	s	D85 F88 F103 A104 E107 H110 R227 M230 L231	D30 F33 F48 A49 E52 H55 R172 M175 L176
BS06	CLA	s	L116 A117 G120 I123 R144 Y146	L61 A62 G65 I68 R89 Y91
BS07	CLA	s	K221 K224	K166 K169
BS08	CHL	s	Y139 G142 E143 P150 Q157	Y84 G87 E88 P95 Q102
BS09	CHL	s	R112 W113 V164 R168 D171 V178 F202	R57 W58 V109 R113 D116 V123 F147
BS10	CLA	s	W102 A106 H110 M158 M161 G162 E165 R168	W47 A51 H55 M103 M106 G107 E110 R113
BS11	CHL	s	Y146 L153 Q157	Y91 L98 Q102
BS12	CHL	s	P66 W68 F69 P70 F86	P11 W13 F14 P15 F31

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f9o, PDBe:7f9o, PDBj:7f9o
PDBsum	7f9o
PubMed	34879391
UniProt	F2D0D5

[Back to BioLiP]