Structure of PDB 6yp7 Chain s

Receptor sequence

>6yp7s (length=218) Species: 3888 (Pisum sativum) [Search protein sequence]

ANEELAKWYGPDRRIFLPDGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKP
EDFAKYQGYELIHARWAMLGAAGFIIPEAFNKYGANCGPEAVWFKTGALL
LDGGTLNYFGKPIPINLILAVVAEVVLLGGAEYYRITNGLDLEDKFHPGG
PFDPLGLANDPDQAAILKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENF
AKHLSDPFGNNLLTVIAG

3D structure

PDB

6yp7 High-Light versus Low-Light: Effects on Paired Photosystem II Supercomplex Structural Rearrangement in Pea Plants.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	s	P36 G38	P18 G20
BS02	CHL	s	F98 Y101	F80 Y83
BS03	CHL	s	F34 L35 P36 Y59	F16 L17 P18 Y41
BS04	CLA	s	L49 G55 D56 Y57 Y59 D60 P61 F62 L64 E78 R194	L31 G37 D38 Y39 Y41 D42 P43 F44 L46 E60 R176
BS05	CLA	s	Y74 Y77 H81	Y56 Y59 H63
BS06	CLA	s	L87 G91 I94 C105 Y126 F127	L69 G73 I76 C87 Y108 F109
BS07	CHL	s	G115 L118 A138 E142	G97 L100 A120 E124
BS08	CHL	s	F112 K113 G115 A116 L135	F94 K95 G97 A98 L117
BS09	CLA	s	I80 W84 E150 I154 K163	I62 W66 E132 I136 K145
BS10	CLA	s	R83 M86 H165 G167 F170 L185 K186 K188 E189	R65 M68 H147 G149 F152 L167 K168 K170 E171
BS11	CLA	s	W26 K188 K191 L195	W8 K170 K173 L177
BS12	CLA	s	K188 N192	K170 N174
BS13	CLA	s	G202 Q206 N217 N229 L230 V233	G184 Q188 N199 N211 L212 V215
BS14	CLA	s	F218 H221 P225 F226 N229 L230	F200 H203 P207 F208 N211 L212

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6yp7, PDBe:6yp7, PDBj:6yp7
PDBsum	6yp7
PubMed	33207833
UniProt	A0A2D0TCJ1

[Back to BioLiP]