Structure of PDB 6ylh Chain s

Receptor sequence

>6ylhs (length=56) Species: 4932 (Saccharomyces cerevisiae)

RVRKRQSRRTSTKLKEGIKKKASAHRKKEKKMAKKKKDPGIPSNFPYKAK
ILEEIE

3D structure

• PDB: 6ylh Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
• Chain: s
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s	R2 R4 R6 Q7 S8 R9 R10 S12 T13 K14 L15 G18 I19 K20 K21 H26 K29 P51	R1 R3 R5 Q6 S7 R8 R9 S11 T12 K13 L14 G17 I18 K19 K20 H25 K28 P42

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0000055 ribosomal large subunit export from nucleus
• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0015031 protein transport
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:6ylh, PDBe:6ylh, PDBj:6ylh
• PDBsum: 6ylh
• PubMed: 32668200
• UniProt: P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 (Gene Name=NUG1)