Structure of PDB 6tnn Chain s

Receptor sequence
>6tnns (length=64) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
PKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVS
AGDFKRIKQMLANI
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chains
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s P2 M4 K5 T6 H7 R8 K12 R13 G18 R24 H26 Y28 S30 H31 L32 F33 N35 K39 Q40 K41 K43 R45 K46 R57 P1 M3 K4 T5 H6 R7 K11 R12 G17 R23 H25 Y27 S29 H30 L31 F32 N34 K38 Q39 K40 K42 R44 K45 R56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP55874|RL35_BACSU Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]