Structure of PDB 6r84 Chain s

Receptor sequence

>6r84s (length=220) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAAQA

3D structure

• PDB: 6r84 Structure and function of Vms1 and Arb1 in RQC and mitochondrial proteome homeostasis.
• Chain: s
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s	Y10 E55 L56 I130 K202 G203 S204 L205	Y10 E55 L56 I130 K202 G203 S204 L205
BS02	rna	s	C104 A105 G106	C104 A105 G106
BS03	rna	s	R2 R3 R6 C7 R9 K12 K14 P15 Y16 Y21 Y33 E62 A66 R89 H91 F93 R97 I98 N99 M101 R109 M114 R115 G116 W118 Q132 R152 R153 Y156 K157 P159 F172 D192 G193 A194 F195 K197	R2 R3 R6 C7 R9 K12 K14 P15 Y16 Y21 Y33 E62 A66 R89 H91 F93 R97 I98 N99 M101 R109 M114 R115 G116 W118 Q132 R152 R153 Y156 K157 P159 F172 D192 G193 A194 F195 K197

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6r84, PDBe:6r84, PDBj:6r84
• PDBsum: 6r84
• PubMed: 31189955
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)