Structure of PDB 6hd7 Chain s

Receptor sequence

>6hd7s (length=220) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAAQA

3D structure

• PDB: 6hd7 Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
• Chain: s
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	s	R3 P4 A5 R6 C7 Y8 R9 K14 P15 Y16 P17 Y21 R23 I32 Y33 D34 K38 E62 A63 A66 R89 H91 F93 R97 M101 S103 C104 Q112 M114 R115 A117 W118 Q132 R152 R153 Y156 K157 P159 G160 Q161 D192 G193 A194 F195 K197	R3 P4 A5 R6 C7 Y8 R9 K14 P15 Y16 P17 Y21 R23 I32 Y33 D34 K38 E62 A63 A66 R89 H91 F93 R97 M101 S103 C104 Q112 M114 R115 A117 W118 Q132 R152 R153 Y156 K157 P159 G160 Q161 D192 G193 A194 F195 K197
BS02	rna	s	Y10 E55 K202 G203 S204 L205 N208	Y10 E55 K202 G203 S204 L205 N208
BS03	rna	s	I69 N72 K73 C104 A105	I69 N72 K73 C104 A105
BS04	rna	s	R23 A24 D108 R109 L110	R23 A24 D108 R109 L110

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hd7, PDBe:6hd7, PDBj:6hd7
• PDBsum: 6hd7
• PubMed: 30559462
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)