Structure of PDB 5t6r Chain s

Receptor sequence
>5t6rs (length=50) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
3D structure
PDB5t6r Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.
Chains
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s A2 E3 S4 H5 R6 Q17 R18 S19 K20 R21 N23 P25 L45 R48 A1 E2 S3 H4 R5 Q16 R17 S18 K19 R20 N22 P24 L44 R47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t6r, PDBe:5t6r, PDBj:5t6r
PDBsum5t6r
PubMed28179369
UniProtP05744|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)

[Back to BioLiP]