Structure of PDB 5mmj Chain s

Receptor sequence
>5mmjs (length=78) Species: 3562 (Spinacia oleracea) [Search protein sequence]
KKNPFVANHLLRKIEKLNKKAEKEIIVTWSRASTIIPTMIGHTIAIHNGR
EHLPIYITDRMVGHKLGEFAPTLNFRGH
3D structure
PDB5mmj The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.
Chains
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide s P9 P42 D64 V67 P4 P37 D59 V62
BS02 rna s F10 H14 W34 R36 H52 G54 R55 K70 G72 T77 L78 N79 F80 H83 F5 H9 W29 R31 H47 G49 R50 K65 G67 T72 L73 N74 F75 H78
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009507 chloroplast
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mmj, PDBe:5mmj, PDBj:5mmj
PDBsum5mmj
PubMed28007896
UniProtP06508|RR19_SPIOL Small ribosomal subunit protein uS19c (Gene Name=rps19)

[Back to BioLiP]