Structure of PDB 5imq Chain s

Receptor sequence
>5imqs (length=79) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRD
FTLFALVDGVVEFQDRGRLGRYVHVRPLA
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
Chains
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna s L7 S9 N12 R14 D15 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 R32 A33 G34 N35 I36 R39 R41 T43 G54 R55 D56 F57 F60 L75 L1 S3 N6 R8 D9 S10 Q11 A12 K13 R14 K18 R19 Y20 E21 R26 A27 G28 N29 I30 R33 R35 T37 G48 R49 D50 F51 F54 L69
BS02 rna s R74 L75 R68 L69
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum5imq
PubMed27137929
UniProtP60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]