Structure of PDB 8bhf Chain r3

Receptor sequence

>8bhfr3 (length=205) Species: 9986 (Oryctolagus cuniculus)

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVVEALRRAKFKF
PGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKW
RALHS

3D structure

• PDB: 8bhf Modulation of GluA2-gamma 5 synaptic complex desensitization, polyamine block and antiepileptic perampanel inhibition by auxiliary subunit cornichon-2.
• Chain: r3
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r3	R3 R4 A6 R7 C8 K13 N14 K15 P16 Y17 R21 F22 R32 F34 D35 S61 E63 A64 A67 R90 H92 F94 R98 Q112 G114 M115 R116 A118 F119 G120 R154 F157 K158 P160 R162 D193 G194 K198	R2 R3 A5 R6 C7 K12 N13 K14 P15 Y16 R20 F21 R31 F33 D34 S60 E62 A63 A66 R89 H91 F93 R97 Q103 G105 M106 R107 A109 F110 G111 R145 F148 K149 P151 R153 D184 G185 K189
BS02	rna	r3	Y11 E56 Y57 I131 Y199 N202 R203 G204 P205 L206	Y10 E55 Y56 I122 Y190 N193 R194 G195 P196 L197

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation
• GO:0006417 regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8bhf, PDBe:8bhf, PDBj:8bhf
• PDBsum: 8bhf
• PubMed: 37653241
• UniProt: B7NZQ2|RL10_RABIT Large ribosomal subunit protein uL16 (Gene Name=RPL10)