Structure of PDB 8b2l Chain r3

Receptor sequence

>8b2lr3 (length=386) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

SHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCKLTAFLGYKA
GMTHIVRDVEKPGSKLHKKETCEAVTIIETPPMVIVGVVGYVKTPRGLRC
LNTVWAQHLSEELKRRFYKNWCKSKKKAFLKYSKKYETDEGKKDIQTQLE
KLKKYACVIRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAQKVDFAYGF
FEKQVPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRK
VACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKLGKAGQESHAAITD
FDRTEKDITPMGGFPHYGVVKDDYLLIKGCCVGPKKRVVTLRQSLLNQTS
RVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFYGRL

3D structure

PDB

8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r3	S2 H3 R4 K5 F6 E7 H8 P9 R10 H11 G12 S13 L14 G15 F16 L17 P18 R19 K20 R21 A23 H25 R26 K28 K30 A31 M53 T54 H55 K62 G64 S65 A75 Y92 T95 R97 L99 R100 C101 N103 T104 R116 R117 F118 Y119 K120 C123 K124 S125 K126 K128 A129 F130 K132 Y133 K152 K155 Y156 R161 K175 Q176 K177 K178 E183 T224 K225 G226 K227 G228 Y229 E230 G231 T234 R235 T239 R240 P242 R243 K244 T245 H246 R247 G248 L249 R250 K251 V252 A253 C254 I255 G256 A257 W258 H259 P260 A261 R262 V263 Y265 T266 R269 A270 Q272 Y275 H277 R278 T279 E280 M281 N282 K283 G313 P316 H317 G319 K329 C331 C332 G334 K336 R338 R352 S367 K368 F369 G370 H371 T377 K380 F383 R386	S1 H2 R3 K4 F5 E6 H7 P8 R9 H10 G11 S12 L13 G14 F15 L16 P17 R18 K19 R20 A22 H24 R25 K27 K29 A30 M52 T53 H54 K61 G63 S64 A74 Y91 T94 R96 L98 R99 C100 N102 T103 R115 R116 F117 Y118 K119 C122 K123 S124 K125 K127 A128 F129 K131 Y132 K151 K154 Y155 R160 K174 Q175 K176 K177 E182 T223 K224 G225 K226 G227 Y228 E229 G230 T233 R234 T238 R239 P241 R242 K243 T244 H245 R246 G247 L248 R249 K250 V251 A252 C253 I254 G255 A256 W257 H258 P259 A260 R261 V262 Y264 T265 R268 A269 Q271 Y274 H276 R277 T278 E279 M280 N281 K282 G312 P315 H316 G318 K328 C330 C331 G333 K335 R337 R351 S366 K367 F368 G369 H370 T376 K379 F382 R385

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8b2l, PDBe:8b2l, PDBj:8b2l
PDBsum	8b2l
PubMed	37156858
UniProt	A0A1S3ZLI9

[Back to BioLiP]